SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5j25a_ (5j25 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060798Protein Endothiapepsin [50647] (1 species)
  7. 2060799Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (500 PDB entries)
  8. 2289356Domain d5j25a_: 5j25 A: [332657]
    automated match to d1oewa_
    complexed with 47k, act, gol

Details for d5j25a_

PDB Entry: 5j25 (more details), 1.24 Å

PDB Description: endothiapepsin in complex with fragment 158
PDB Compounds: (A:) endothiapepsin

SCOPe Domain Sequences for d5j25a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j25a_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOPe Domain Coordinates for d5j25a_:

Click to download the PDB-style file with coordinates for d5j25a_.
(The format of our PDB-style files is described here.)

Timeline for d5j25a_:

  • d5j25a_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06