SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5izca_ (5izc A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2090925Protein Dihydropteridin reductase (pteridine reductase) [51769] (7 species)
  7. 2090996Species Trypanosoma brucei [TaxId:5702] [226783] (15 PDB entries)
  8. 2289352Domain d5izca_: 5izc A: [332653]
    automated match to d3bmob_
    complexed with 6f4, act, gol, nap

Details for d5izca_

PDB Entry: 5izc (more details), 1.92 Å

PDB Description: trypanosoma brucei ptr1 in complex with inhibitor f032
PDB Compounds: (A:) pteridine reductase

SCOPe Domain Sequences for d5izca_:

Sequence, based on SEQRES records: (download)

>d5izca_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma brucei [TaxId: 5702]}
eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqva
eligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkhal
vgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadav
iflvsgsaqyitgsiikvdgglslvha

Sequence, based on observed residues (ATOM records): (download)

>d5izca_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma brucei [TaxId: 5702]}
eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvgktvetqvaeligtnaia
pflltmsfaqrqsnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirv
ngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikv
dgglslvha

SCOPe Domain Coordinates for d5izca_:

Click to download the PDB-style file with coordinates for d5izca_.
(The format of our PDB-style files is described here.)

Timeline for d5izca_:

  • d5izca_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06