SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mtja_ (5mtj A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2184972Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2184973Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2185424Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2185425Protein automated matches [190561] (4 species)
    not a true protein
  7. 2185493Species Mouse (Mus musculus) [TaxId:10090] [226265] (5 PDB entries)
  8. 2289350Domain d5mtja_: 5mtj A: [332651]
    Other proteins in same PDB: d5mtjb_
    automated match to d3uyoa_
    complexed with cxs, so4

Details for d5mtja_

PDB Entry: 5mtj (more details), 1.95 Å

PDB Description: yes1-sh2 in complex with monobody mb(yes_1)
PDB Compounds: (A:) Tyrosine-protein kinase Yes

SCOPe Domain Sequences for d5mtja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mtja_ d.93.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qaeewyfgkmgrkdaerlllnpgnqrgiflvresettkgayslsirdwdevrgdnvkhyk
irkldnggyyittraqfdtlqklvkhytehadglchklttvcptvkpqt

SCOPe Domain Coordinates for d5mtja_:

Click to download the PDB-style file with coordinates for d5mtja_.
(The format of our PDB-style files is described here.)

Timeline for d5mtja_:

  • d5mtja_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06