SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ksue2 (5ksu E:93-189)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (859 PDB entries)
  8. 2289349Domain d5ksue2: 5ksu E:93-189 [332650]
    Other proteins in same PDB: d5ksua1, d5ksua2, d5ksub1, d5ksud1, d5ksud2, d5ksue1
    automated match to d1sebb1

Details for d5ksue2

PDB Entry: 5ksu (more details), 2.73 Å

PDB Description: crystal structure of hla-dq2.5-clip1 at 2.73 resolution
PDB Compounds: (E:) MHC class II HLA-DQ-beta-1

SCOPe Domain Sequences for d5ksue2:

Sequence, based on SEQRES records: (download)

>d5ksue2 b.1.1.0 (E:93-189) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeetagvvstplirngd
wtfqilvmlemtpqrgdvytchvehpslqspitvewr

Sequence, based on observed residues (ATOM records): (download)

>d5ksue2 b.1.1.0 (E:93-189) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispsnllvcsvtdfypaqikvrwfrndqeetagvvstplirngdwtfqilvm
lemtpqrgdvytchvehpslqspitvewr

SCOPe Domain Coordinates for d5ksue2:

Click to download the PDB-style file with coordinates for d5ksue2.
(The format of our PDB-style files is described here.)

Timeline for d5ksue2:

  • d5ksue2 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06