Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (27 families) |
Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
Protein automated matches [190220] (14 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [311380] (18 PDB entries) |
Domain d5ldsa4: 5lds A:634-963 [332645] Other proteins in same PDB: d5ldsa1, d5ldsa2, d5ldsa3, d5ldsb1, d5ldsb2, d5ldsb3, d5ldsc1, d5ldsc2, d5ldsc3, d5ldsd1, d5ldsd2, d5ldsd3 automated match to d4fkha4 complexed with act, bma, nag, zn |
PDB Entry: 5lds (more details), 2 Å
SCOPe Domain Sequences for d5ldsa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ldsa4 a.118.1.0 (A:634-963) automated matches {Pig (Sus scrofa) [TaxId: 9823]} dnwrmiqhqlqtnlsvipvinraqviydsfnlatahmvpvtlaldntlflngekeympwq aalsslsyfslmfdrsevygpmkkylrkqveplfqhfetltknwterpenlmdqyseina istacsnglpqcenlaktlfdqwmsdpennpihpnlrstiycnaiaqggqdqwdfawgql qqaqlvneadklrsalacsnevwllnrylgytlnpdlirkqdatstinsiasnvigqpla wdfvqsnwkklfqdygggsfsfsnliqgvtrrfssefelqqleqfkknnmdvgfgsgtra leqalektkanikwvkenkevvlnwfiehs
Timeline for d5ldsa4: