SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ldsa3 (5lds A:545-633)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2033616Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2033638Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 2033639Protein automated matches [254707] (4 species)
    not a true protein
  7. 2033663Species Pig (Sus scrofa) [TaxId:9823] [311379] (11 PDB entries)
  8. 2289343Domain d5ldsa3: 5lds A:545-633 [332644]
    Other proteins in same PDB: d5ldsa1, d5ldsa2, d5ldsa4, d5ldsb1, d5ldsb2, d5ldsb4, d5ldsc1, d5ldsc2, d5ldsc4, d5ldsd1, d5ldsd2, d5ldsd4
    automated match to d4fkha3
    complexed with act, bma, nag, zn

Details for d5ldsa3

PDB Entry: 5lds (more details), 2 Å

PDB Description: structure of the porcine aminopeptidase n ectodomain
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d5ldsa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ldsa3 b.1.30.0 (A:545-633) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
fpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvsqa
qndlfktasddwvllnvnvtgyfqvnyde

SCOPe Domain Coordinates for d5ldsa3:

Click to download the PDB-style file with coordinates for d5ldsa3.
(The format of our PDB-style files is described here.)

Timeline for d5ldsa3:

  • d5ldsa3 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06