Lineage for d5ldsa3 (5lds A:545-633)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2033616Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2033638Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 2033639Protein automated matches [254707] (4 species)
    not a true protein
  7. 2033663Species Pig (Sus scrofa) [TaxId:9823] [311379] (11 PDB entries)
  8. 2289343Domain d5ldsa3: 5lds A:545-633 [332644]
    Other proteins in same PDB: d5ldsa1, d5ldsa2, d5ldsa4, d5ldsb1, d5ldsb2, d5ldsb4, d5ldsc1, d5ldsc2, d5ldsc4, d5ldsd1, d5ldsd2, d5ldsd4
    automated match to d4fkha3
    complexed with act, bma, nag, zn

Details for d5ldsa3

PDB Entry: 5lds (more details), 2 Å

PDB Description: structure of the porcine aminopeptidase n ectodomain
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d5ldsa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ldsa3 b.1.30.0 (A:545-633) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
fpvitvdtktgnisqkhflldsesnvtrssafdylwivpissikngvmqdhywlrdvsqa
qndlfktasddwvllnvnvtgyfqvnyde

SCOPe Domain Coordinates for d5ldsa3:

Click to download the PDB-style file with coordinates for d5ldsa3.
(The format of our PDB-style files is described here.)

Timeline for d5ldsa3:

  • d5ldsa3 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06