SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ldsa1 (5lds A:61-282)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2074640Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2074641Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2074713Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2074714Protein automated matches [254706] (5 species)
    not a true protein
  7. 2074741Species Pig (Sus scrofa) [TaxId:9823] [311377] (10 PDB entries)
  8. 2289341Domain d5ldsa1: 5lds A:61-282 [332642]
    Other proteins in same PDB: d5ldsa2, d5ldsa3, d5ldsa4, d5ldsb2, d5ldsb3, d5ldsb4, d5ldsc2, d5ldsc3, d5ldsc4, d5ldsd2, d5ldsd3, d5ldsd4
    automated match to d4fkha1
    complexed with act, bma, nag, zn

Details for d5ldsa1

PDB Entry: 5lds (more details), 2 Å

PDB Description: structure of the porcine aminopeptidase n ectodomain
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d5ldsa1:

Sequence, based on SEQRES records: (download)

>d5ldsa1 b.98.1.0 (A:61-282) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
ldqskpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrficqeptdviiihs
kklnyttqghmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqge
laddlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnlta
lsnmppkgsstplaedpnwsvtefettpvmstyllayivsef

Sequence, based on observed residues (ATOM records): (download)

>d5ldsa1 b.98.1.0 (A:61-282) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
ldqskpwnryrlpttllpdsynvtlrpyltpnadglyifkgksivrficqeptdviiihs
kklnythmvvlrgvgdsqvpeidrtelvelteylvvhlkgslqpghmyemesefqgelad
dlagfyrseymegnvkkvlattqmqstdarksfpcfdepamkatfnitlihpnnltalsn
mppkgsstplaedpnwsvtefettpvmstyllayivsef

SCOPe Domain Coordinates for d5ldsa1:

Click to download the PDB-style file with coordinates for d5ldsa1.
(The format of our PDB-style files is described here.)

Timeline for d5ldsa1:

  • d5ldsa1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06