SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mo4a2 (5mo4 A:140-240)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2184972Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2184973Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2185424Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2185425Protein automated matches [190561] (4 species)
    not a true protein
  7. 2185426Species Human (Homo sapiens) [TaxId:9606] [187549] (47 PDB entries)
  8. 2289339Domain d5mo4a2: 5mo4 A:140-240 [332640]
    Other proteins in same PDB: d5mo4a1, d5mo4a3
    automated match to d1opla2
    complexed with ay7, nil

Details for d5mo4a2

PDB Entry: 5mo4 (more details), 2.17 Å

PDB Description: abl1 kinase (t334i_d382n) in complex with asciminib and nilotinib
PDB Compounds: (A:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d5mo4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mo4a2 d.93.1.0 (A:140-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintas
dgklyvssesrfntlaelvhhhstvadglittlhypapkrn

SCOPe Domain Coordinates for d5mo4a2:

Click to download the PDB-style file with coordinates for d5mo4a2.
(The format of our PDB-style files is described here.)

Timeline for d5mo4a2:

  • d5mo4a2 appears in periodic updates to SCOPe 2.06 starting on 2017-04-05