Lineage for d5mo4a2 (5mo4 A:140-240)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2184972Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2184973Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2185424Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2185425Protein automated matches [190561] (4 species)
    not a true protein
  7. 2185426Species Human (Homo sapiens) [TaxId:9606] [187549] (47 PDB entries)
  8. 2289339Domain d5mo4a2: 5mo4 A:140-240 [332640]
    Other proteins in same PDB: d5mo4a1, d5mo4a3
    automated match to d1opla2
    complexed with ay7, nil

Details for d5mo4a2

PDB Entry: 5mo4 (more details), 2.17 Å

PDB Description: abl1 kinase (t334i_d382n) in complex with asciminib and nilotinib
PDB Compounds: (A:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d5mo4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mo4a2 d.93.1.0 (A:140-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintas
dgklyvssesrfntlaelvhhhstvadglittlhypapkrn

SCOPe Domain Coordinates for d5mo4a2:

Click to download the PDB-style file with coordinates for d5mo4a2.
(The format of our PDB-style files is described here.)

Timeline for d5mo4a2:

  • d5mo4a2 appears in periodic updates to SCOPe 2.06 starting on 2017-04-05