SCOPe 2.06: Domain d5j1ya2: 5j1y A:95-214

Lineage for d5j1ya2 (5j1y A:95-214)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Ethr repressor [109978] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [109979] (34 PDB entries)
   Uniprot P96222 22-215

8. Domain d5j1ya2: 5j1y A:95-214 [332636]
   Other proteins in same PDB: d5j1ya1
   automated match to d1t56a2
   complexed with p87

Details for d5j1ya2

PDB Entry: 5j1y, 1.81 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with 1-(pyrrolidin-1-yl)-3- (tetrahydrofuran-3-yl)propan-1-one at 1.81a resolution

PDB Compounds: (A:) EthR

SCOPe Domain Sequences for d5j1ya2:

Sequence; same for both SEQRES and ATOM records:

>d5j1ya2 a.121.1.1 (A:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

Timeline for d5j1ya2:

• d5j1ya2 is new in SCOPe 2.06-stable
  
• d5j1ya2 appears in SCOPe 2.07
  
• d5j1ya2 appears in the current release, SCOPe 2.08