SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hxna_ (5hxn A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148252Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156
  4. 2148253Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) (S)
    the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase
  5. 2148319Family c.101.1.0: automated matches [191361] (1 protein)
    not a true family
  6. 2148320Protein automated matches [190431] (7 species)
    not a true protein
  7. 2289224Species Solanum habrochaites [TaxId:62890] [332525] (5 PDB entries)
  8. 2289324Domain d5hxna_: 5hxn A: [332625]
    automated match to d4h8ea_
    mutant

Details for d5hxna_

PDB Entry: 5hxn (more details), 2.05 Å

PDB Description: crystal structure of z,z-farnesyl diphosphate synthase (d71m and e75a mutants) from the wild tomato solanum habrochaites
PDB Compounds: (A:) (2Z,6Z)-farnesyl diphosphate synthase, chloroplastic

SCOPe Domain Sequences for d5hxna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hxna_ c.101.1.0 (A:) automated matches {Solanum habrochaites [TaxId: 62890]}
lmpkhialimdgnrrwakdkgldvseghkhlfpklkeicdissklgiqvitafafstenw
krakgevdflmqmfeelydefsrsgvrvsiigcktdlpmtlqkcialteettkgnkglhl
vialnyggyydilqatksivnkamnglldvedinknlfdqeleskcpnpdllirtggdqr
vsnfllwqlaytefyftktlfpdfgeedlkeaiinfqqrh

SCOPe Domain Coordinates for d5hxna_:

Click to download the PDB-style file with coordinates for d5hxna_.
(The format of our PDB-style files is described here.)

Timeline for d5hxna_:

  • d5hxna_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-05