SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ksud1 (5ksu D:0-81)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2163004Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2163005Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2163984Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2163985Protein automated matches [226842] (4 species)
    not a true protein
  7. 2163998Species Human (Homo sapiens) [TaxId:9606] [226044] (63 PDB entries)
  8. 2289321Domain d5ksud1: 5ksu D:0-81 [332622]
    Other proteins in same PDB: d5ksua2, d5ksub2, d5ksud2, d5ksue2
    automated match to d4ozfa1

Details for d5ksud1

PDB Entry: 5ksu (more details), 2.73 Å

PDB Description: crystal structure of hla-dq2.5-clip1 at 2.73 resolution
PDB Compounds: (D:) HLA class II histocompatibility antigen, DQ alpha 1 chain

SCOPe Domain Sequences for d5ksud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ksud1 d.19.1.0 (D:0-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqfa
ltniavlkhnlnslikrsnsta

SCOPe Domain Coordinates for d5ksud1:

Click to download the PDB-style file with coordinates for d5ksud1.
(The format of our PDB-style files is described here.)

Timeline for d5ksud1:

  • d5ksud1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-05