Lineage for d5izdd_ (5izd D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (48 species)
    not a true protein
  7. 2289258Species Thermoplasma acidophilum [TaxId:2303] [332559] (1 PDB entry)
  8. 2289318Domain d5izdd_: 5izd D: [332619]
    Other proteins in same PDB: d5izda2
    automated match to d4pz2a_
    complexed with nap

Details for d5izdd_

PDB Entry: 5izd (more details), 2.05 Å

PDB Description: wild-type glyceraldehyde dehydrogenase from thermoplasma acidophilum in complex with nadp
PDB Compounds: (D:) D-glyceraldehyde dehydrogenase (NADP(+))

SCOPe Domain Sequences for d5izdd_:

Sequence, based on SEQRES records: (download)

>d5izdd_ c.82.1.0 (D:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
mdtklyidgqwvnsssgktvdkyspvtgqvigrfeaatrddvdraidaaedafwawndlg
sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
yfflptiignadqkskifqeeifapvigarkissveemydlandskyglasylftkdpni
ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
plhintvrddlf

Sequence, based on observed residues (ATOM records): (download)

>d5izdd_ c.82.1.0 (D:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
mdtklyidgqwvnsssgktvdkyspvtgqvigrfeaatrddvdraidaaedafwawndlg
sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpyrngyfflp
tiignadqkskifqeeifapvigarkissveemydlandskyglasylftkdpniifeas
erirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgkplhin
tvrddlf

SCOPe Domain Coordinates for d5izdd_:

Click to download the PDB-style file with coordinates for d5izdd_.
(The format of our PDB-style files is described here.)

Timeline for d5izdd_:

  • d5izdd_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06