SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5izdd_ (5izd D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (42 species)
    not a true protein
  7. 2289258Species Thermoplasma acidophilum [TaxId:2303] [332559] (1 PDB entry)
  8. 2289318Domain d5izdd_: 5izd D: [332619]
    Other proteins in same PDB: d5izda2
    automated match to d4pz2a_
    complexed with nap

Details for d5izdd_

PDB Entry: 5izd (more details), 2.05 Å

PDB Description: wild-type glyceraldehyde dehydrogenase from thermoplasma acidophilum in complex with nadp
PDB Compounds: (D:) D-glyceraldehyde dehydrogenase (NADP(+))

SCOPe Domain Sequences for d5izdd_:

Sequence, based on SEQRES records: (download)

>d5izdd_ c.82.1.0 (D:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
mdtklyidgqwvnsssgktvdkyspvtgqvigrfeaatrddvdraidaaedafwawndlg
sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
yfflptiignadqkskifqeeifapvigarkissveemydlandskyglasylftkdpni
ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
plhintvrddlf

Sequence, based on observed residues (ATOM records): (download)

>d5izdd_ c.82.1.0 (D:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
mdtklyidgqwvnsssgktvdkyspvtgqvigrfeaatrddvdraidaaedafwawndlg
sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpyrngyfflp
tiignadqkskifqeeifapvigarkissveemydlandskyglasylftkdpniifeas
erirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgkplhin
tvrddlf

SCOPe Domain Coordinates for d5izdd_:

Click to download the PDB-style file with coordinates for d5izdd_.
(The format of our PDB-style files is described here.)

Timeline for d5izdd_:

  • d5izdd_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-06