SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5izda1 (5izd A:1-493)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (46 species)
    not a true protein
  7. 2289258Species Thermoplasma acidophilum [TaxId:2303] [332559] (1 PDB entry)
  8. 2289316Domain d5izda1: 5izd A:1-493 [332617]
    Other proteins in same PDB: d5izda2
    automated match to d4pz2a_
    complexed with nap

Details for d5izda1

PDB Entry: 5izd (more details), 2.05 Å

PDB Description: wild-type glyceraldehyde dehydrogenase from thermoplasma acidophilum in complex with nadp
PDB Compounds: (A:) D-glyceraldehyde dehydrogenase (NADP(+))

SCOPe Domain Sequences for d5izda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5izda1 c.82.1.0 (A:1-493) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
mdtklyidgqwvnsssgktvdkyspvtgqvigrfeaatrddvdraidaaedafwawndlg
sverskiiyrakelieknraeleniimeengkpvkeakeevdgvidqiqyyaewarklng
evvegtsshrkifqykvpygivvaltpwnfpagmvarklapalltgntvvlkpssdtpgs
aewivrkfveagvpkgvlnfitgrgseigdyivehkkvnlitmtgstatgqrimqkasan
maklilelggkapfmvwkdadmdnalktllwakywnagqsciaaerlyvhediydtfmsr
fvelsrklalgdpknadmgplinkgalqatseiveeakesgakilfggsqpslsgpyrng
yfflptiignadqkskifqeeifapvigarkissveemydlandskyglasylftkdpni
ifeaserirfgelyvnmpgpeasqgyhtgfrmtgqagegskygiseylklkniyvdysgk
plhintvrddlfq

SCOPe Domain Coordinates for d5izda1:

Click to download the PDB-style file with coordinates for d5izda1.
(The format of our PDB-style files is described here.)

Timeline for d5izda1:

  • d5izda1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06