SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5g5db2 (5g5d B:104-163)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012910Fold a.139: Type I dockerin domain [63445] (1 superfamily)
    tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand
  4. 2012911Superfamily a.139.1: Type I dockerin domain [63446] (2 families) (S)
  5. 2012929Family a.139.1.0: automated matches [191542] (1 protein)
    not a true family
  6. 2012930Protein automated matches [190928] (7 species)
    not a true protein
  7. 2012949Species Clostridium thermocellum [TaxId:203119] [194257] (3 PDB entries)
  8. 2289309Domain d5g5db2: 5g5d B:104-163 [332610]
    Other proteins in same PDB: d5g5da_, d5g5db1
    automated match to d2b59b1
    complexed with ca

Details for d5g5db2

PDB Entry: 5g5d (more details), 3 Å

PDB Description: crystal structure of the cohscac2-xdoccipa type ii complex from clostridium thermocellum
PDB Compounds: (B:) Cellulosomal-scaffolding protein A

SCOPe Domain Sequences for d5g5db2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g5db2 a.139.1.0 (B:104-163) automated matches {Clostridium thermocellum [TaxId: 203119]}
vkdnsinlldvaevircfnatkgsanyveeldinrngainmqdimivhkhfgatssdyda

SCOPe Domain Coordinates for d5g5db2:

Click to download the PDB-style file with coordinates for d5g5db2.
(The format of our PDB-style files is described here.)

Timeline for d5g5db2:

  • d5g5db2 appears in periodic updates to SCOPe 2.06 starting on 2017-04-05

View in 3D
Domains from same chain:
(mouse over for more information)
d5g5db1
View in 3D
Domains from other chains:
(mouse over for more information)
d5g5da_