SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5g5db1 (5g5d B:8-103)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2034780Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2034930Superfamily b.3.2: Carboxypeptidase regulatory domain-like [49464] (3 families) (S)
  5. 2034939Family b.3.2.2: Pre-dockerin domain [141082] (2 protein domains)
    PfamB PB085396
  6. 2289306Protein automated matches [332607] (1 species)
    not a true protein
  7. 2289307Species Clostridium thermocellum [TaxId:203119] [332608] (1 PDB entry)
  8. 2289308Domain d5g5db1: 5g5d B:8-103 [332609]
    Other proteins in same PDB: d5g5da_, d5g5db2
    automated match to d2b59b2
    complexed with ca

Details for d5g5db1

PDB Entry: 5g5d (more details), 3 Å

PDB Description: crystal structure of the cohscac2-xdoccipa type ii complex from clostridium thermocellum
PDB Compounds: (B:) Cellulosomal-scaffolding protein A

SCOPe Domain Sequences for d5g5db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g5db1 b.3.2.2 (B:8-103) automated matches {Clostridium thermocellum [TaxId: 203119]}
gykvsgyilpdfsfdatvaplvkagfkveivgtelyavtdangyfeitgvpanasgytlk
isratyldrvianvvvtgdtsvstsqapimmwvgki

SCOPe Domain Coordinates for d5g5db1:

Click to download the PDB-style file with coordinates for d5g5db1.
(The format of our PDB-style files is described here.)

Timeline for d5g5db1:

  • d5g5db1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-05

View in 3D
Domains from same chain:
(mouse over for more information)
d5g5db2
View in 3D
Domains from other chains:
(mouse over for more information)
d5g5da_