SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k7qa_ (5k7q A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2041900Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 2041901Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 2041902Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 protein domains)
    automatically mapped to Pfam PF00314
  6. 2041910Protein Thaumatin [49876] (1 species)
  7. 2041911Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (84 PDB entries)
    Uniprot P02883
  8. 2289305Domain d5k7qa_: 5k7q A: [332606]
    automated match to d1kwna_

Details for d5k7qa_

PDB Entry: 5k7q (more details), 2.5 Å

PDB Description: microed structure of thaumatin at 2.5 a resolution
PDB Compounds: (A:) Thaumatin-1

SCOPe Domain Sequences for d5k7qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k7qa_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOPe Domain Coordinates for d5k7qa_:

Click to download the PDB-style file with coordinates for d5k7qa_.
(The format of our PDB-style files is described here.)

Timeline for d5k7qa_:

  • d5k7qa_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-05