SCOPe 2.06: Domain d5l9na_: 5l9n A:

Lineage for d5l9na_ (5l9n A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)

6. Protein PII (product of glnB) [54915] (8 species)
   trimer with orthogonal packing of beta-sheets around the threefold axis

7. Species Escherichia coli [TaxId:83333] [332601] (1 PDB entry)

8. Domain d5l9na_: 5l9n A: [332602]
   automated match to d2piia_
   complexed with atp, mg

Details for d5l9na_

PDB Entry: 5l9n, 1.9 Å

PDB Description: structure of uridylylated glnb from escherichia coli bound to atp

PDB Compounds: (A:) Nitrogen regulatory protein P-II 1

SCOPe Domain Sequences for d5l9na_:

Sequence, based on SEQRES records:

>d5l9na_ d.58.5.1 (A:) PII (product of glnB) {Escherichia coli [TaxId: 83333]}
mkkidaiikpfklddvrealaevgitgmtvtevkgfgrqkghtelyrgaeymvdflpkvk
ieivvpddivdtcvdtiirtaqtgkigdgkifvfdvarvirirtgeedd

Sequence, based on observed residues (ATOM records):

>d5l9na_ d.58.5.1 (A:) PII (product of glnB) {Escherichia coli [TaxId: 83333]}
mkkidaiikpfklddvrealaevgitgmtvtevkgfdflpkvkieivvpddivdtcvdti
irtaqtgkigdgkifvfdvarvirirtgeedd

Timeline for d5l9na_:

• d5l9na_ is new in SCOPe 2.06-stable
  
• d5l9na_ appears in SCOPe 2.07
  
• d5l9na_ appears in the current release, SCOPe 2.08