SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5l9na_ (5l9n A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2173456Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2173457Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 protein domains)
  6. 2173463Protein PII (product of glnB) [54915] (8 species)
    trimer with orthogonal packing of beta-sheets around the threefold axis
  7. 2289300Species Escherichia coli [TaxId:83333] [332601] (1 PDB entry)
  8. 2289301Domain d5l9na_: 5l9n A: [332602]
    automated match to d2piia_
    complexed with atp, mg

Details for d5l9na_

PDB Entry: 5l9n (more details), 1.9 Å

PDB Description: structure of uridylylated glnb from escherichia coli bound to atp
PDB Compounds: (A:) Nitrogen regulatory protein P-II 1

SCOPe Domain Sequences for d5l9na_:

Sequence, based on SEQRES records: (download)

>d5l9na_ d.58.5.1 (A:) PII (product of glnB) {Escherichia coli [TaxId: 83333]}
mkkidaiikpfklddvrealaevgitgmtvtevkgfgrqkghtelyrgaeymvdflpkvk
ieivvpddivdtcvdtiirtaqtgkigdgkifvfdvarvirirtgeedd

Sequence, based on observed residues (ATOM records): (download)

>d5l9na_ d.58.5.1 (A:) PII (product of glnB) {Escherichia coli [TaxId: 83333]}
mkkidaiikpfklddvrealaevgitgmtvtevkgfdflpkvkieivvpddivdtcvdti
irtaqtgkigdgkifvfdvarvirirtgeedd

SCOPe Domain Coordinates for d5l9na_:

Click to download the PDB-style file with coordinates for d5l9na_.
(The format of our PDB-style files is described here.)

Timeline for d5l9na_:

  • d5l9na_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-05