Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (42 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [332591] (1 PDB entry) |
Domain d5ix3a1: 5ix3 A:1-165 [332592] Other proteins in same PDB: d5ix3a2 automated match to d4jlya_ |
PDB Entry: 5ix3 (more details), 1.81 Å
SCOPe Domain Sequences for d5ix3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ix3a1 d.108.1.0 (A:1-165) automated matches {Staphylococcus aureus [TaxId: 1280]} mklraleysdllfvhelnneysimsywfeepyesltelqhlfdkhlldeserrfiveden qvvgivelveinyihrnceiqiiikpefsgkgyakfafekaiiyafnilnmhkiylyvda dnkkaihiyesegfktegllkeqfytkgkykdayfmsllkseyil
Timeline for d5ix3a1: