Lineage for d5ix3a1 (5ix3 A:1-165)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209749Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2209750Protein automated matches [190038] (42 species)
    not a true protein
  7. 2210003Species Staphylococcus aureus [TaxId:1280] [332591] (1 PDB entry)
  8. 2210004Domain d5ix3a1: 5ix3 A:1-165 [332592]
    Other proteins in same PDB: d5ix3a2
    automated match to d4jlya_

Details for d5ix3a1

PDB Entry: 5ix3 (more details), 1.81 Å

PDB Description: crystal structure of n-acetyltransferase from staphylococcus aureus.
PDB Compounds: (A:) Diamine N-acetyltransferase

SCOPe Domain Sequences for d5ix3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ix3a1 d.108.1.0 (A:1-165) automated matches {Staphylococcus aureus [TaxId: 1280]}
mklraleysdllfvhelnneysimsywfeepyesltelqhlfdkhlldeserrfiveden
qvvgivelveinyihrnceiqiiikpefsgkgyakfafekaiiyafnilnmhkiylyvda
dnkkaihiyesegfktegllkeqfytkgkykdayfmsllkseyil

SCOPe Domain Coordinates for d5ix3a1:

Click to download the PDB-style file with coordinates for d5ix3a1.
(The format of our PDB-style files is described here.)

Timeline for d5ix3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ix3a2