SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ix3a1 (5ix3 A:1-165)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187564Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2187565Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2188102Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2188103Protein automated matches [190038] (37 species)
    not a true protein
  7. 2289290Species Staphylococcus aureus [TaxId:1280] [332591] (1 PDB entry)
  8. 2289291Domain d5ix3a1: 5ix3 A:1-165 [332592]
    Other proteins in same PDB: d5ix3a2
    automated match to d4jlya_

Details for d5ix3a1

PDB Entry: 5ix3 (more details), 1.81 Å

PDB Description: crystal structure of n-acetyltransferase from staphylococcus aureus.
PDB Compounds: (A:) Diamine N-acetyltransferase

SCOPe Domain Sequences for d5ix3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ix3a1 d.108.1.0 (A:1-165) automated matches {Staphylococcus aureus [TaxId: 1280]}
mklraleysdllfvhelnneysimsywfeepyesltelqhlfdkhlldeserrfiveden
qvvgivelveinyihrnceiqiiikpefsgkgyakfafekaiiyafnilnmhkiylyvda
dnkkaihiyesegfktegllkeqfytkgkykdayfmsllkseyil

SCOPe Domain Coordinates for d5ix3a1:

Click to download the PDB-style file with coordinates for d5ix3a1.
(The format of our PDB-style files is described here.)

Timeline for d5ix3a1:

  • d5ix3a1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-05

View in 3D
Domains from same chain:
(mouse over for more information)
d5ix3a2