SCOPe 2.08: Domain d5hxpa_: 5hxp A:

Lineage for d5hxpa_ (5hxp A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.0: automated matches [191361] (1 protein)
   not a true family

6. Protein automated matches [190431] (13 species)
   not a true protein

7. Species Solanum habrochaites [TaxId:62890] [332525] (5 PDB entries)

8. Domain d5hxpa_: 5hxp A: [332589]
   automated match to d4h8ea_
   complexed with ipr, mg, o4b; mutant

Details for d5hxpa_

PDB Entry: 5hxp, 1.95 Å

PDB Description: crystal structure of z,z-farnesyl diphosphate synthase (d71m, e75a and h103y mutants) complexed with ipp

PDB Compounds: (A:) (2Z,6Z)-farnesyl diphosphate synthase, chloroplastic

SCOPe Domain Sequences for d5hxpa_:

Sequence, based on SEQRES records:

>d5hxpa_ c.101.1.0 (A:) automated matches {Solanum habrochaites [TaxId: 62890]}
ldealmpkhialimdgnrrwakdkgldvsegykhlfpklkeicdissklgiqvitafafs
tenwkrakgevdflmqmfeelydefsrsgvrvsiigcktdlpmtlqkcialteettkgnk
glhlvialnyggyydilqatksivnkamnglldvedinknlfdqeleskcpnpdllirtg
gdqrvsnfllwqlaytefyftktlfpdfgeedlkeaiinfqqrhrrfggh

Sequence, based on observed residues (ATOM records):

>d5hxpa_ c.101.1.0 (A:) automated matches {Solanum habrochaites [TaxId: 62890]}
ldealmpkhialimdgnrrwakdkgldvsegykhlfpklkeicdissklgiqvitafafs
tenevdflmqmfeelydefsrsgvrvsiigcktdlpmtlqkcialteettkgnkglhlvi
alnyggyydilqatksivnkamnglldvedinknlfdqeleskcpnpdllirtggdqrvs
nfllwqlaytefyftktlfpdfgeedlkeaiinfqqrhrrfggh

Timeline for d5hxpa_:

• d5hxpa_ first appeared in SCOPe 2.06
  
• d5hxpa_ appears in SCOPe 2.07