SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lhdc1 (5lhd C:63-287)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2074640Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2074641Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2074713Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2074714Protein automated matches [254706] (5 species)
    not a true protein
  7. 2074718Species Human (Homo sapiens) [TaxId:9606] [255964] (16 PDB entries)
  8. 2289284Domain d5lhdc1: 5lhd C:63-287 [332585]
    Other proteins in same PDB: d5lhda2, d5lhda3, d5lhda4, d5lhdb2, d5lhdb3, d5lhdb4, d5lhdc2, d5lhdc3, d5lhdc4, d5lhdd2, d5lhdd3, d5lhdd4
    automated match to d4fyqa1
    complexed with bma, edo, nag, zn

Details for d5lhdc1

PDB Entry: 5lhd (more details), 2.6 Å

PDB Description: structure of glycosylated human aminopeptidase n
PDB Compounds: (C:) Aminopeptidase N

SCOPe Domain Sequences for d5lhdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lhdc1 b.98.1.0 (C:63-287) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ttldqskawnryrlpntlkpdsyrvtlrpyltpndrglyvfkgsstvrftckeatdviii
hskklnytlsqghrvvlrgvggsqppdidktelvepteylvvhlkgslvkdsqyemdsef
egeladdlagfyrseymegnvrkvvattqmqaadarksfpcfdepamkaefnitlihpkd
ltalsnmlpkgpstplpedpnwnvtefhttpkmstyllafivsef

SCOPe Domain Coordinates for d5lhdc1:

Click to download the PDB-style file with coordinates for d5lhdc1.
(The format of our PDB-style files is described here.)

Timeline for d5lhdc1:

  • d5lhdc1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06