SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gnka_ (5gnk A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2196778Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species)
    PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2196779Species Human (Homo sapiens) [TaxId:9606] [82796] (83 PDB entries)
    Uniprot P00533 702-1018
  8. 2289282Domain d5gnka_: 5gnk A: [332583]
    automated match to d4riyb_
    complexed with 80u, cl, edo, no3

Details for d5gnka_

PDB Entry: 5gnk (more details), 1.8 Å

PDB Description: crystal structure of egfr 696-988 t790m in complex with lxx-6-34
PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d5gnka_:

Sequence, based on SEQRES records: (download)

>d5gnka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
eapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkan
keildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqylln
wcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkv
pikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqp
pictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgde

Sequence, based on observed residues (ATOM records): (download)

>d5gnka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
eapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkan
keildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqylln
wcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgvpikwmalesilh
riythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimv
kcwmidadsrpkfreliiefskmardpqrylviqgde

SCOPe Domain Coordinates for d5gnka_:

Click to download the PDB-style file with coordinates for d5gnka_.
(The format of our PDB-style files is described here.)

Timeline for d5gnka_:

  • d5gnka_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-05