SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ldsc2 (5lds C:283-544)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183652Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2183653Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2184728Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2184729Protein automated matches [190805] (17 species)
    not a true protein
  7. 2184824Species Pig (Sus scrofa) [TaxId:9823] [311378] (11 PDB entries)
  8. 2289279Domain d5ldsc2: 5lds C:283-544 [332580]
    Other proteins in same PDB: d5ldsa1, d5ldsa3, d5ldsa4, d5ldsb1, d5ldsb3, d5ldsb4, d5ldsc1, d5ldsc3, d5ldsc4, d5ldsd1, d5ldsd3, d5ldsd4
    automated match to d4fkha2
    complexed with act, bma, nag, zn

Details for d5ldsc2

PDB Entry: 5lds (more details), 2 Å

PDB Description: structure of the porcine aminopeptidase n ectodomain
PDB Compounds: (C:) Aminopeptidase N

SCOPe Domain Sequences for d5ldsc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ldsc2 d.92.1.0 (C:283-544) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
qsvnetaqngvliriwarpnaiaeghgmyalnvtgpilnffanhyntsyplpksdqialp
dfnagamenwglvtyrenallfdpqsssisnkervvtviahelahqwfgnlvtlawwndl
wlnegfasyveylgadhaeptwnlkdlivpgdvyrvmavdalasshplttpaeevntpaq
isemfdsisyskgasvirmlsnfltedlfkeglasylhafayqnttyldlwehlqkavda
qtsirlpdtvraimdrwtlqmg

SCOPe Domain Coordinates for d5ldsc2:

Click to download the PDB-style file with coordinates for d5ldsc2.
(The format of our PDB-style files is described here.)

Timeline for d5ldsc2:

  • d5ldsc2 appears in periodic updates to SCOPe 2.06 starting on 2017-04-06