Lineage for d5j3jb2 (5j3j B:509-766)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (90 species)
    not a true protein
  7. 2136259Species Human (Homo sapiens) [TaxId:9606] [188340] (71 PDB entries)
  8. 2289277Domain d5j3jb2: 5j3j B:509-766 [332578]
    Other proteins in same PDB: d5j3ja1, d5j3jb1
    automated match to d1orva2
    complexed with hl1, man, nag

Details for d5j3jb2

PDB Entry: 5j3j (more details), 2.75 Å

PDB Description: crystal structure of human dpp-iv in complex with hl1
PDB Compounds: (B:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d5j3jb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j3jb2 c.69.1.0 (B:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d5j3jb2:

Click to download the PDB-style file with coordinates for d5j3jb2.
(The format of our PDB-style files is described here.)

Timeline for d5j3jb2:

  • d5j3jb2 appears in periodic updates to SCOPe 2.06 starting on 2017-04-05

View in 3D
Domains from same chain:
(mouse over for more information)
d5j3jb1