SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5j3jb1 (5j3j B:40-508)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2066579Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2066692Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 2066693Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 protein domains)
    Pfam PF00930
  6. 2066700Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 2066701Species Human (Homo sapiens) [TaxId:9606] [82174] (91 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 2289276Domain d5j3jb1: 5j3j B:40-508 [332577]
    Other proteins in same PDB: d5j3ja2, d5j3jb2
    automated match to d1orva1
    complexed with hl1, man, nag

Details for d5j3jb1

PDB Entry: 5j3j (more details), 2.75 Å

PDB Description: crystal structure of human dpp-iv in complex with hl1
PDB Compounds: (B:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d5j3jb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j3jb1 b.70.3.1 (B:40-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOPe Domain Coordinates for d5j3jb1:

Click to download the PDB-style file with coordinates for d5j3jb1.
(The format of our PDB-style files is described here.)

Timeline for d5j3jb1:

  • d5j3jb1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-05

View in 3D
Domains from same chain:
(mouse over for more information)
d5j3jb2