Lineage for d5ldsd2 (5lds D:283-544)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964873Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2964874Protein automated matches [190805] (20 species)
    not a true protein
  7. 2965055Species Pig (Sus scrofa) [TaxId:9823] [311378] (18 PDB entries)
  8. 2965065Domain d5ldsd2: 5lds D:283-544 [332574]
    Other proteins in same PDB: d5ldsa1, d5ldsa3, d5ldsa4, d5ldsb1, d5ldsb3, d5ldsb4, d5ldsc1, d5ldsc3, d5ldsc4, d5ldsd1, d5ldsd3, d5ldsd4
    automated match to d4fkha2
    complexed with act, nag, zn

Details for d5ldsd2

PDB Entry: 5lds (more details), 2 Å

PDB Description: structure of the porcine aminopeptidase n ectodomain
PDB Compounds: (D:) Aminopeptidase N

SCOPe Domain Sequences for d5ldsd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ldsd2 d.92.1.0 (D:283-544) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
qsvnetaqngvliriwarpnaiaeghgmyalnvtgpilnffanhyntsyplpksdqialp
dfnagamenwglvtyrenallfdpqsssisnkervvtviahelahqwfgnlvtlawwndl
wlnegfasyveylgadhaeptwnlkdlivpgdvyrvmavdalasshplttpaeevntpaq
isemfdsisyskgasvirmlsnfltedlfkeglasylhafayqnttyldlwehlqkavda
qtsirlpdtvraimdrwtlqmg

SCOPe Domain Coordinates for d5ldsd2:

Click to download the PDB-style file with coordinates for d5ldsd2.
(The format of our PDB-style files is described here.)

Timeline for d5ldsd2: