Lineage for d5jzba_ (5jzb A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (88 species)
    not a true protein
  7. 2136432Species Mycobacterium tuberculosis [TaxId:83332] [189096] (7 PDB entries)
  8. 2289268Domain d5jzba_: 5jzb A: [332569]
    automated match to d2vf2a_
    complexed with 6ot, po4

Details for d5jzba_

PDB Entry: 5jzb (more details), 2.1 Å

PDB Description: crystal structure of hsad bound to 3,5-dichlorobenzene sulphonamide
PDB Compounds: (A:) 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase

SCOPe Domain Sequences for d5jzba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jzba_ c.69.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ltfestsrfaevdvdgplklhyheagvgndqtvvllhgggpgaaswtnfsrniavlarhf
hvlavdqpgyghsdkraehgqfnryaamalkglfdqlglgrvplvgnslgggtavrfald
yparagrlvlmgpgglsinlfapdptegvkrlskfsvaptrenleaflrvmvydknlitp
elvdqrfalastpesltatramgksfagadfeagmmwrevyrlrqpvlliwgredrvnpl
dgalvalktipraqlhvfgqcghwvqvekfdefnkltieflg

SCOPe Domain Coordinates for d5jzba_:

Click to download the PDB-style file with coordinates for d5jzba_.
(The format of our PDB-style files is described here.)

Timeline for d5jzba_:

  • d5jzba_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-05