SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k7ra_ (5k7r A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056829Protein Trypsin(ogen) [50515] (9 species)
  7. 2056847Species Cow (Bos taurus) [TaxId:9913] [50516] (404 PDB entries)
    Uniprot P00760
  8. 2289267Domain d5k7ra_: 5k7r A: [332568]
    automated match to d1j8aa_
    complexed with ca

Details for d5k7ra_

PDB Entry: 5k7r (more details), 1.7 Å

PDB Description: microed structure of trypsin at 1.7 a resolution
PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d5k7ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k7ra_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d5k7ra_:

Click to download the PDB-style file with coordinates for d5k7ra_.
(The format of our PDB-style files is described here.)

Timeline for d5k7ra_:

  • d5k7ra_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-05