SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jvjb1 (5jvj B:2-380)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2194861Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2194862Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2195231Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2195232Protein automated matches [226904] (32 species)
    not a true protein
  7. 2289251Species Flaveria trinervia [TaxId:4227] [332552] (3 PDB entries)
  8. 2289252Domain d5jvjb1: 5jvj B:2-380 [332553]
    Other proteins in same PDB: d5jvja2, d5jvja3, d5jvjb2, d5jvjb3
    automated match to d1vbga3
    complexed with mg, pep

Details for d5jvjb1

PDB Entry: 5jvj (more details), 2.9 Å

PDB Description: c4-type pyruvate phosphate dikinase: different conformational states of the nucleotide binding domain in the dimer
PDB Compounds: (B:) Pyruvate, phosphate dikinase, chloroplastic

SCOPe Domain Sequences for d5jvjb1:

Sequence, based on SEQRES records: (download)

>d5jvjb1 d.142.1.0 (B:2-380) automated matches {Flaveria trinervia [TaxId: 4227]}
krvftfgkgrsegnrdmksllggkganlaemssiglsvppgltisteaceeyqqngkslp
pglwdeisegldyvqkemsaslgdpskplllsvrsgaaismpgmmdtvlnlglndevvag
lagksgarfaydsyrrfldmfgnvvmgiphslfdekleqmkaekgihldtdltaadlkdl
vekyknvyveakgekfptdpkkqlelavnavfdswdsprankyrsinqitglkgtavniq
smvfgnmgntsgtgvlftrnpstgekklygeflinaqgedvvagirtpedlgtmetcmpe
aykelvenceilerhykdmmdieftvqenrlwmlqcrtgkrtgkgavriavdmvneglid
trtaikrvetqhldqllhp

Sequence, based on observed residues (ATOM records): (download)

>d5jvjb1 d.142.1.0 (B:2-380) automated matches {Flaveria trinervia [TaxId: 4227]}
krvftfgkgrsegnrdggkganlaemssiglsvppgltisdeisegldyvqkemsaskpl
llsvrsgaaidtvlnlglndevvksgarfaydsyrrfldmfgnvvmgiphslfdekleqm
kihldtdltaadlkdlvekyknvyvetdpkkqlelavnavfdsavniqsmvfgnmgntsg
tgvlftrnpstgekklygeflinaqgedvvagirtpedlgtmetcmpeaykelvenceil
erhykdmmdieftvqenrlwmlqcrtgkrtgkgavriavdmvneglidtrtaikrvetqh
ldqllhp

SCOPe Domain Coordinates for d5jvjb1:

Click to download the PDB-style file with coordinates for d5jvjb1.
(The format of our PDB-style files is described here.)

Timeline for d5jvjb1:

  • d5jvjb1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-05