SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k7pa_ (5k7p A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2043667Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 protein domains)
  6. 2043712Protein Xylanase II [49979] (19 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2043786Species Hypocrea jecorina [TaxId:51453] [277348] (4 PDB entries)
  8. 2289248Domain d5k7pa_: 5k7p A: [332549]
    automated match to d3aksa_
    complexed with iod

Details for d5k7pa_

PDB Entry: 5k7p (more details), 2.3 Å

PDB Description: microed structure of xylanase at 2.3 a resolution
PDB Compounds: (A:) Endo-1,4-beta-xylanase 2

SCOPe Domain Sequences for d5k7pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k7pa_ b.29.1.11 (A:) Xylanase II {Hypocrea jecorina [TaxId: 51453]}
qtiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

SCOPe Domain Coordinates for d5k7pa_:

Click to download the PDB-style file with coordinates for d5k7pa_.
(The format of our PDB-style files is described here.)

Timeline for d5k7pa_:

  • d5k7pa_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-05