SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jjcd_ (5jjc D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2140083Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2140084Protein automated matches [190215] (29 species)
    not a true protein
  7. 2289246Species Brucella abortus [TaxId:430066] [332547] (2 PDB entries)
  8. 2289247Domain d5jjcd_: 5jjc D: [332548]
    automated match to d4airb_
    mutant

Details for d5jjcd_

PDB Entry: 5jjc (more details), 2.01 Å

PDB Description: crystal structure of double mutant (q96a-y125a) o-acetyl serine sulfhydralase from brucella abortus
PDB Compounds: (D:) Cysteine synthase

SCOPe Domain Sequences for d5jjcd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jjcd_ c.79.1.0 (D:) automated matches {Brucella abortus [TaxId: 430066]}
mfnsvldtigntplirlskaseltgcdiygkaeflnpgqsvkdraalyiirdaekrgllr
pggvivegtagntgigltmvakalgyrtaivipetasqekkdalrllgaelievpaapyr
npnnavrlsgrlaeqlaktepngaiwanqfdntvnrqahiettaqeiwrdtsdqidgfva
avgsggtlagtaiglkernhnikialadphgaalhafyttgelkaegdsitegigqgrit
anlegftpdfsyqipdaealdilfalveeeglclggssginiagairlakdlgpghtivt
vlcdygnryqsklfnpaflrgkslpvprwle

SCOPe Domain Coordinates for d5jjcd_:

Click to download the PDB-style file with coordinates for d5jjcd_.
(The format of our PDB-style files is described here.)

Timeline for d5jjcd_:

  • d5jjcd_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-05