SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gv7a2 (5gv7 A:1126-1272)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105127Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2105128Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2105129Family c.25.1.1: Reductases [52344] (5 protein domains)
  6. 2105130Protein cytochrome b5 reductase [52357] (3 species)
  7. 2105138Species Pig (Sus scrofa), liver [TaxId:9823] [52358] (9 PDB entries)
  8. 2289245Domain d5gv7a2: 5gv7 A:1126-1272 [332546]
    Other proteins in same PDB: d5gv7a1
    automated match to d1ndha2
    complexed with fad, gol

Details for d5gv7a2

PDB Entry: 5gv7 (more details), 0.8 Å

PDB Description: structure of nadh-cytochrome b5 reductase refined with the multipolar atomic model at 0.80 a
PDB Compounds: (A:) NADH-cytochrome b5 reductase 3

SCOPe Domain Sequences for d5gv7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gv7a2 c.25.1.1 (A:1126-1272) cytochrome b5 reductase {Pig (Sus scrofa), liver [TaxId: 9823]}
gkfairpdkksspviktvksvgmiaggtgitpmlqviraimkdpddhtvchllfanqtek
dillrpeleelrnehsarfklwytvdrapeawdysqgfvneemirdhlpppeeeplvlmc
gpppmiqyaclpnlervghpkercfaf

SCOPe Domain Coordinates for d5gv7a2:

Click to download the PDB-style file with coordinates for d5gv7a2.
(The format of our PDB-style files is described here.)

Timeline for d5gv7a2:

  • d5gv7a2 appears in periodic updates to SCOPe 2.06 starting on 2017-04-05

View in 3D
Domains from same chain:
(mouse over for more information)
d5gv7a1