SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gv7a1 (5gv7 A:1001-1125)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2054165Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2054655Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2054692Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 protein domains)
    coupled with a NADP-binding domain of alpha/beta class
  6. 2054697Protein cytochrome b5 reductase [50427] (3 species)
  7. 2054705Species Pig (Sus scrofa), liver [TaxId:9823] [50428] (9 PDB entries)
  8. 2289244Domain d5gv7a1: 5gv7 A:1001-1125 [332545]
    Other proteins in same PDB: d5gv7a2
    automated match to d1ndha1
    complexed with fad, gol

Details for d5gv7a1

PDB Entry: 5gv7 (more details), 0.8 Å

PDB Description: structure of nadh-cytochrome b5 reductase refined with the multipolar atomic model at 0.80 a
PDB Compounds: (A:) NADH-cytochrome b5 reductase 3

SCOPe Domain Sequences for d5gv7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gv7a1 b.43.4.2 (A:1001-1125) cytochrome b5 reductase {Pig (Sus scrofa), liver [TaxId: 9823]}
stpaitlenpdikyplrlidkevvnhdtrrfrfalpspehilglpvgqhiylsaridgnl
virpytpvssdddkgfvdlvikvyfkdthpkfpaggkmsqylesmkigdtiefrgpngll
vyqgk

SCOPe Domain Coordinates for d5gv7a1:

Click to download the PDB-style file with coordinates for d5gv7a1.
(The format of our PDB-style files is described here.)

Timeline for d5gv7a1:

  • d5gv7a1 appears in periodic updates to SCOPe 2.06 starting on 2017-04-05

View in 3D
Domains from same chain:
(mouse over for more information)
d5gv7a2