SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ih7a_ (5ih7 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134064Family c.69.1.1: Acetylcholinesterase-like [53475] (6 protein domains)
    automatically mapped to Pfam PF00135
  6. 2134065Protein Acetylcholinesterase [53476] (5 species)
  7. 2134137Species Pacific electric ray (Torpedo californica) [TaxId:7787] [53477] (87 PDB entries)
    Uniprot P04058 25-556
  8. 2289242Domain d5ih7a_: 5ih7 A: [332543]
    automated match to d2dfpa_
    complexed with act, nag, omi, pg4

Details for d5ih7a_

PDB Entry: 5ih7 (more details), 2.4 Å

PDB Description: acetylcholinesterase of torpedo californica in complex with the n- methyl-indoxylacetate hydrolysis products
PDB Compounds: (A:) acetylcholinesterase

SCOPe Domain Sequences for d5ih7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ih7a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]}
dhsellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnas
typnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfy
sgsstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvh
dniqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaeg
rrravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeff
ptslesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvp
handlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtyly
ffnhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgn
pnephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat

SCOPe Domain Coordinates for d5ih7a_:

Click to download the PDB-style file with coordinates for d5ih7a_.
(The format of our PDB-style files is described here.)

Timeline for d5ih7a_:

  • d5ih7a_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-05