Lineage for d5gv8a2 (5gv8 A:1126-1272)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105127Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2105128Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2105129Family c.25.1.1: Reductases [52344] (5 protein domains)
  6. 2105130Protein cytochrome b5 reductase [52357] (3 species)
  7. 2105138Species Pig (Sus scrofa), liver [TaxId:9823] [52358] (9 PDB entries)
  8. 2289231Domain d5gv8a2: 5gv8 A:1126-1272 [332532]
    Other proteins in same PDB: d5gv8a1
    automated match to d1ndha2
    complexed with fad, gol

Details for d5gv8a2

PDB Entry: 5gv8 (more details), 0.78 Å

PDB Description: structure of nadh-cytochrome b5 reductase refined with the multipolar atomic model at 0.78a
PDB Compounds: (A:) NADH-cytochrome b5 reductase 3

SCOPe Domain Sequences for d5gv8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gv8a2 c.25.1.1 (A:1126-1272) cytochrome b5 reductase {Pig (Sus scrofa), liver [TaxId: 9823]}
gkfairpdkksspviktvksvgmiaggtgitpmlqviraimkdpddhtvchllfanqtek
dillrpeleelrnehsarfklwytvdrapeawdysqgfvneemirdhlpppeeeplvlmc
gpppmiqyaclpnlervghpkercfaf

SCOPe Domain Coordinates for d5gv8a2:

Click to download the PDB-style file with coordinates for d5gv8a2.
(The format of our PDB-style files is described here.)

Timeline for d5gv8a2:

  • d5gv8a2 appears in periodic updates to SCOPe 2.06 starting on 2017-04-05

View in 3D
Domains from same chain:
(mouse over for more information)
d5gv8a1