SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5g5da_ (5g5d A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2033752Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2033774Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2033894Family b.2.2.0: automated matches [191610] (1 protein)
    not a true family
  6. 2033895Protein automated matches [191113] (9 species)
    not a true protein
  7. 2289223Species Ruminiclostridium thermocellum [TaxId:1138384] [332524] (1 PDB entry)
  8. 2289227Domain d5g5da_: 5g5d A: [332528]
    Other proteins in same PDB: d5g5db1, d5g5db2
    automated match to d4fl4b_
    complexed with ca

Details for d5g5da_

PDB Entry: 5g5d (more details), 3 Å

PDB Description: crystal structure of the cohscac2-xdoccipa type ii complex from clostridium thermocellum
PDB Compounds: (A:) Cellulosome anchoring protein cohesin region

SCOPe Domain Sequences for d5g5da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g5da_ b.2.2.0 (A:) automated matches {Ruminiclostridium thermocellum [TaxId: 1138384]}
ahialeldktkvkvgdvivatvkaknmtsmagiqvnikydpevlqaidpatgkpftketl
lvdpellsnreynplltavndinsgiinyascyvywdsyresgvsestgiigkvgfkvlk
aanttvkleetrftpnsidgtlvidwygqqivgykviqpd

SCOPe Domain Coordinates for d5g5da_:

Click to download the PDB-style file with coordinates for d5g5da_.
(The format of our PDB-style files is described here.)

Timeline for d5g5da_:

  • d5g5da_ appears in periodic updates to SCOPe 2.06 starting on 2017-04-05