SCOPe 2.06: Domain d5mmdf_: 5mmd F:

Lineage for d5mmdf_ (5mmd F:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (18 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [332487] (1 PDB entry)

8. Domain d5mmdf_: 5mmd F: [332517]
   automated match to d1jjeb_
   complexed with cl, zn

Details for d5mmdf_

PDB Entry: 5mmd, 1.75 Å

PDB Description: tmb-1. structural insights into tmb-1 and the role of residue 119 and 228 in substrate and inhibitor binding

PDB Compounds: (F:) Metallo-beta-lactamase 1

SCOPe Domain Sequences for d5mmdf_:

Sequence; same for both SEQRES and ATOM records:

>d5mmdf_ d.157.1.0 (F:) automated matches {Acinetobacter baumannii [TaxId: 470]}
ipgleveeidngvflhksysrvegwglvssnglvvisggkafiidtpwsesdteklvdwi
rskkyelagsisthshedktagikwlngksittyasaltneilkregkeqarssfkgnef
slmdgflevyypggghtidnlvvwipsskilyggcfirslessglgytgeakidqwpqsa
rntiskypeakivvpghgkigdfellkhtkvlaekasn

Timeline for d5mmdf_:

• d5mmdf_ is new in SCOPe 2.06-stable
  
• d5mmdf_ appears in SCOPe 2.07
  
• d5mmdf_ appears in the current release, SCOPe 2.08