SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5v19b_ (5v19 B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2199241Species Human (Homo sapiens) [TaxId:9606] [187294] (813 PDB entries)
  8. 2289206Domain d5v19b_: 5v19 B: [332507]
    automated match to d2clqa_
    complexed with 8v4

Details for d5v19b_

PDB Entry: 5v19 (more details), 3.1 Å

PDB Description: structure-based drug design of novel ask1 inhibitors using a fully integrated lead optimization strategy
PDB Compounds: (B:) mitogen-activated protein kinase kinase kinase 5

SCOPe Domain Sequences for d5v19b_:

Sequence, based on SEQRES records: (download)

>d5v19b_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lleydyeydengdrvvlgkgtygivyagrdlsnqvriaikeiperdsrysqplheeialh
khlkhknivqylgsfsengfikifmeqvpggslsallrskwgplkdneqtigfytkqile
glkylhdnqivhrdikgdnvlintysgvlkisdfgtskrlaginpctetftgtlqymape
iidkgprgygkaadiwslgctiiematgkppfyelgepqaamfkvgmfkvhpeipesmsa
eakafilkcfepdpdkracandllvdeflkv

Sequence, based on observed residues (ATOM records): (download)

>d5v19b_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lleydyeydengdrvvlgkgtygivyagrdlsnqvriaikeiperqplheeialhkhlkh
knivqylgsfsengfikifmeqvpggslsallrskwgplkdneqtigfytkqileglkyl
hdnqivhrdikgdnvlintysgvlkisdfgtskrctetftgtlqymapeiidkgprgygk
aadiwslgctiiematgkppfyelgepqaamfkvgmfkvhpeipesmsaeakafilkcfe
pdpdkracandllvdeflkv

SCOPe Domain Coordinates for d5v19b_:

Click to download the PDB-style file with coordinates for d5v19b_.
(The format of our PDB-style files is described here.)

Timeline for d5v19b_:

  • d5v19b_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30