Lineage for d5x7fa_ (5x7f A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (64 species)
    not a true protein
  7. 2289204Species Mycobacterium tuberculosis [TaxId:83332] [332505] (1 PDB entry)
  8. 2289205Domain d5x7fa_: 5x7f A: [332506]
    automated match to d3cbga_
    complexed with sam

Details for d5x7fa_

PDB Entry: 5x7f (more details), 2 Å

PDB Description: structure of a o-methyltransferase from mycobacterium tuberculosis at 2.0 resolution
PDB Compounds: (A:) Putative O-methyltransferase Rv1220c

SCOPe Domain Sequences for d5x7fa_:

Sequence, based on SEQRES records: (download)

>d5x7fa_ c.66.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
eslwahaegsisedvilagareratdigagavtpavgallcllaklsggkavaevgtgag
vsglwllsgmrddgvlttidiepehlrlarqafaeagigpsrtrlisgraqevltrlada
sydlvfidadpidqpdyvaegvrllrsggvivvhraalggragdpgardaeviavreaar
liaederltpalvplgdgvlaavrd

Sequence, based on observed residues (ATOM records): (download)

>d5x7fa_ c.66.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
eslwahaegsisedvilagareratdigagavtpavgallcllaklsggkavaevgtgag
vsglwllsgmrddgvlttidiepehlrlarqafaeagigpsrtrlisgraqevltrlada
sydlvfidadpidqpdyvaegvrllrsggvivvhraalgardaeviavreaarliaeder
ltpalvplgdgvlaavrd

SCOPe Domain Coordinates for d5x7fa_:

Click to download the PDB-style file with coordinates for d5x7fa_.
(The format of our PDB-style files is described here.)

Timeline for d5x7fa_:

  • d5x7fa_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30