SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5x7fa_ (5x7f A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (61 species)
    not a true protein
  7. 2289204Species Mycobacterium tuberculosis [TaxId:83332] [332505] (1 PDB entry)
  8. 2289205Domain d5x7fa_: 5x7f A: [332506]
    automated match to d3cbga_
    complexed with sam

Details for d5x7fa_

PDB Entry: 5x7f (more details), 2 Å

PDB Description: structure of a o-methyltransferase from mycobacterium tuberculosis at 2.0 resolution
PDB Compounds: (A:) Putative O-methyltransferase Rv1220c

SCOPe Domain Sequences for d5x7fa_:

Sequence, based on SEQRES records: (download)

>d5x7fa_ c.66.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
eslwahaegsisedvilagareratdigagavtpavgallcllaklsggkavaevgtgag
vsglwllsgmrddgvlttidiepehlrlarqafaeagigpsrtrlisgraqevltrlada
sydlvfidadpidqpdyvaegvrllrsggvivvhraalggragdpgardaeviavreaar
liaederltpalvplgdgvlaavrd

Sequence, based on observed residues (ATOM records): (download)

>d5x7fa_ c.66.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
eslwahaegsisedvilagareratdigagavtpavgallcllaklsggkavaevgtgag
vsglwllsgmrddgvlttidiepehlrlarqafaeagigpsrtrlisgraqevltrlada
sydlvfidadpidqpdyvaegvrllrsggvivvhraalgardaeviavreaarliaeder
ltpalvplgdgvlaavrd

SCOPe Domain Coordinates for d5x7fa_:

Click to download the PDB-style file with coordinates for d5x7fa_.
(The format of our PDB-style files is described here.)

Timeline for d5x7fa_:

  • d5x7fa_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30