SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uzoc_ (5uzo C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080703Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2080704Protein automated matches [227084] (14 species)
    not a true protein
  7. 2080757Species Clostridium perfringens [TaxId:195103] [258287] (9 PDB entries)
  8. 2289203Domain d5uzoc_: 5uzo C: [332504]
    automated match to d4q33a_
    complexed with 8q4, imp

Details for d5uzoc_

PDB Entry: 5uzo (more details), 2.21 Å

PDB Description: crystal structure of inosine 5'-monophosphate dehydrogenase from clostridium perfringens complexed with imp and p225
PDB Compounds: (C:) Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d5uzoc_:

Sequence, based on SEQRES records: (download)

>d5uzoc_ c.1.5.0 (C:) automated matches {Clostridium perfringens [TaxId: 195103]}
rilktaytfddvllvpnksevlpnevslktqltkkiqlniplmsasmdtvteskmaiama
reggigiihknmtiedqarevdrvkrsggllcgasigvtndmmervdavvkakvdvivld
tahghskgviegvkrikakypelqviagniatpeavrdlaeagadcvkvgigpgsicttr
ivagvgvpqltavmdcaeegkklgipviadgglkysgdivkalaagacaammgsifagce
eapgaieiyqgrsykvyrgmgslgamakgssdryfqngtkkfvpegvegriaykghladt
iyqliggiksgmgylgaptlenlyenanfvvqtsagfreshphdinitkeapnys

Sequence, based on observed residues (ATOM records): (download)

>d5uzoc_ c.1.5.0 (C:) automated matches {Clostridium perfringens [TaxId: 195103]}
rilktaytfddvllvpnksevlpnevslktqltkkiqlniplmsasmdtvteskmaiama
reggigiihknmtiedqarevdrvkrsggllcgasigvtndmmervdavvkakvdvivld
tahghskgviegvkrikakypelqviagniatpeavrdlaeagadcvkvgigpgsicttr
ivagvgvpqltavmdcaeegkklgipviadgglkysgdivkalaagacaammgsifagce
eapgaieiyqgrsykvyrgmgslgamakfvpegvegriaykghladtiyqliggiksgmg
ylgaptlenlyenanfvvqtsagfreshphdinitkeapnys

SCOPe Domain Coordinates for d5uzoc_:

Click to download the PDB-style file with coordinates for d5uzoc_.
(The format of our PDB-style files is described here.)

Timeline for d5uzoc_:

  • d5uzoc_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30