Lineage for d5ukfa_ (5ukf A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (26 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (936 PDB entries)
  8. 2547347Domain d5ukfa_: 5ukf A: [332498]
    automated match to d3op5a_
    complexed with 8e1, cl, peg, po4

Details for d5ukfa_

PDB Entry: 5ukf (more details), 2.4 Å

PDB Description: crystal structure of the human vaccinia-related kinase 1 bound to an oxindole inhibitor
PDB Compounds: (A:) Serine/threonine-protein kinase VRK1

SCOPe Domain Sequences for d5ukfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ukfa_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeqfavgeiitdmaaaawkvglpigqggfgciyladmnssesvgsdapcvvkvepsdngp
lftelkfyqraakpeqiqkwirtrklkylgvpkywgsglhdkngksyrfmimdrfgsdlq
kiyeanakrfsrktvlqlslrildileyiheheyvhgdikasnlllnyknpdqvylvdyg
layrycpegvhkayaadpkrchdgtieftsidahngvapsrrgdleilgycmiqwltghl
pwednlkdpkyvrdskiryreniaslmdkcfpaanapgeiakymetvklldytekplyen
lrdillqglkaigskddgkldl

SCOPe Domain Coordinates for d5ukfa_:

Click to download the PDB-style file with coordinates for d5ukfa_.
(The format of our PDB-style files is described here.)

Timeline for d5ukfa_: