SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ukfd_ (5ukf D:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2199241Species Human (Homo sapiens) [TaxId:9606] [187294] (778 PDB entries)
  8. 2289193Domain d5ukfd_: 5ukf D: [332494]
    automated match to d3op5a_
    complexed with 8e1, cl, peg, po4

Details for d5ukfd_

PDB Entry: 5ukf (more details), 2.4 Å

PDB Description: crystal structure of the human vaccinia-related kinase 1 bound to an oxindole inhibitor
PDB Compounds: (D:) Serine/threonine-protein kinase VRK1

SCOPe Domain Sequences for d5ukfd_:

Sequence, based on SEQRES records: (download)

>d5ukfd_ d.144.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vglpigqggfgciyladmnssesvgsdapcvvkvepsdngplftelkfyqraakpeqiqk
wirtrklkylgvpkywgsglhdkngksyrfmimdrfgsdlqkiyeanakrfsrktvlqls
lrildileyiheheyvhgdikasnlllnyknpdqvylvdyglayrycpegvhkayaadpk
rchdgtieftsidahngvapsrrgdleilgycmiqwltghlpwednlkdpkyvrdskiry
reniaslmdkcfpaanapgeiakymetvklldytekplyenlrdillqglkaigskddgk
ldl

Sequence, based on observed residues (ATOM records): (download)

>d5ukfd_ d.144.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vglpciyladvvkvgplftelkfyqraakpeqiqkwirtrklkylgvpkywgsgfmimdr
fgsdlqkiyeanakrfsrktvlqlslrildileyiheheyvhgdikasnlllnyknpdqv
ylvdyglayrycpegvhkayaadpkrchdgtieftsidahngvapsrrgdleilgycmiq
wltghlpwednlkdpkyvrdskiryreniaslmdkcfpaanapgeiakymetvklldyte
kplyenlrdillqglkaigskddgkldl

SCOPe Domain Coordinates for d5ukfd_:

Click to download the PDB-style file with coordinates for d5ukfd_.
(The format of our PDB-style files is described here.)

Timeline for d5ukfd_:

  • d5ukfd_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30