Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein automated matches [190140] (37 species) not a true protein |
Species Xanthomonas axonopodis [TaxId:190486] [332492] (1 PDB entry) |
Domain d5um2a1: 5um2 A:51-364 [332493] Other proteins in same PDB: d5um2a2 automated match to d1sbpa_ complexed with gol, so4 |
PDB Entry: 5um2 (more details), 1.14 Å
SCOPe Domain Sequences for d5um2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5um2a1 c.94.1.1 (A:51-364) automated matches {Xanthomonas axonopodis [TaxId: 190486]} reigllnvsydptrefyrdynaafaaqwkqqhpqdtvtvetshggsgkqaravidgiead vvtlalaydvdaiaqkaklietdwekrlpdnsapytstivflvrkgnpknihdwpdllrs gvavvtpnpktsggarwnylaawayadhifkgdrerilrymqalfrnvpvldtgargatt tfvqrgigdvllaweneallareelgkdkfeivvpklsilaepsvalvdknvdkhgtrev aeaylrylyapegqklaakhfyrprhpefadpadiarfpeiklvtiqqafgswekaqqeh fadggvfdqiqank
Timeline for d5um2a1: