SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5um2a1 (5um2 A:51-364)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2145191Protein automated matches [190140] (25 species)
    not a true protein
  7. 2289191Species Xanthomonas axonopodis [TaxId:190486] [332492] (1 PDB entry)
  8. 2289192Domain d5um2a1: 5um2 A:51-364 [332493]
    Other proteins in same PDB: d5um2a2
    automated match to d1sbpa_
    complexed with gol, so4

Details for d5um2a1

PDB Entry: 5um2 (more details), 1.14 Å

PDB Description: functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri
PDB Compounds: (A:) ABC transporter sulfate binding protein

SCOPe Domain Sequences for d5um2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5um2a1 c.94.1.1 (A:51-364) automated matches {Xanthomonas axonopodis [TaxId: 190486]}
reigllnvsydptrefyrdynaafaaqwkqqhpqdtvtvetshggsgkqaravidgiead
vvtlalaydvdaiaqkaklietdwekrlpdnsapytstivflvrkgnpknihdwpdllrs
gvavvtpnpktsggarwnylaawayadhifkgdrerilrymqalfrnvpvldtgargatt
tfvqrgigdvllaweneallareelgkdkfeivvpklsilaepsvalvdknvdkhgtrev
aeaylrylyapegqklaakhfyrprhpefadpadiarfpeiklvtiqqafgswekaqqeh
fadggvfdqiqank

SCOPe Domain Coordinates for d5um2a1:

Click to download the PDB-style file with coordinates for d5um2a1.
(The format of our PDB-style files is described here.)

Timeline for d5um2a1:

  • d5um2a1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5um2a2