Lineage for d5um2a1 (5um2 A:51-364)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2145191Protein automated matches [190140] (30 species)
    not a true protein
  7. 2289191Species Xanthomonas axonopodis [TaxId:190486] [332492] (1 PDB entry)
  8. 2289192Domain d5um2a1: 5um2 A:51-364 [332493]
    Other proteins in same PDB: d5um2a2
    automated match to d1sbpa_
    complexed with gol, so4

Details for d5um2a1

PDB Entry: 5um2 (more details), 1.14 Å

PDB Description: functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri
PDB Compounds: (A:) ABC transporter sulfate binding protein

SCOPe Domain Sequences for d5um2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5um2a1 c.94.1.1 (A:51-364) automated matches {Xanthomonas axonopodis [TaxId: 190486]}
reigllnvsydptrefyrdynaafaaqwkqqhpqdtvtvetshggsgkqaravidgiead
vvtlalaydvdaiaqkaklietdwekrlpdnsapytstivflvrkgnpknihdwpdllrs
gvavvtpnpktsggarwnylaawayadhifkgdrerilrymqalfrnvpvldtgargatt
tfvqrgigdvllaweneallareelgkdkfeivvpklsilaepsvalvdknvdkhgtrev
aeaylrylyapegqklaakhfyrprhpefadpadiarfpeiklvtiqqafgswekaqqeh
fadggvfdqiqank

SCOPe Domain Coordinates for d5um2a1:

Click to download the PDB-style file with coordinates for d5um2a1.
(The format of our PDB-style files is described here.)

Timeline for d5um2a1:

  • d5um2a1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5um2a2