SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t4la_ (5t4l A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2130992Family c.67.1.1: AAT-like [53384] (17 protein domains)
  6. 2131052Protein Aspartate aminotransferase, AAT [53385] (8 species)
  7. 2131087Species Escherichia coli [TaxId:562] [53390] (82 PDB entries)
    Uniprot P00509
  8. 2289190Domain d5t4la_: 5t4l A: [332491]
    automated match to d1arta_
    complexed with 77e

Details for d5t4la_

PDB Entry: 5t4l (more details), 1.53 Å

PDB Description: plp and gaba trigger gabr-mediated transcription regulation in bacillus subsidies via external aldimine formation
PDB Compounds: (A:) aspartate aminotransferase

SCOPe Domain Sequences for d5t4la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t4la_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]}
mfenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllene
ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
assysknfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsn
dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
lreefgvyavasgrvnvagmtpdnmaplceaivavl

SCOPe Domain Coordinates for d5t4la_:

Click to download the PDB-style file with coordinates for d5t4la_.
(The format of our PDB-style files is described here.)

Timeline for d5t4la_:

  • d5t4la_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30