SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jnua_ (5jnu A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116033Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2116034Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2116035Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 protein domains)
    automatically mapped to Pfam PF01451
  6. 2116059Protein Tyrosine phosphatase [52790] (5 species)
  7. 2116080Species Mouse (Mus musculus) [TaxId:10090] [187979] (2 PDB entries)
  8. 2289189Domain d5jnua_: 5jnu A: [332490]
    automated match to d5pnta_
    complexed with po4

Details for d5jnua_

PDB Entry: 5jnu (more details), 2.54 Å

PDB Description: crystal structure of mouse low-molecular weight protein tyrosine phosphatase type a (lmptp-a) complexed with phosphate
PDB Compounds: (A:) Low molecular weight phosphotyrosine protein phosphatase

SCOPe Domain Sequences for d5jnua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jnua_ c.44.1.1 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]}
gsksvlfvclgnicrspiaeavfrklvtdekvsdnwridsaatstyevgnppdyrgqncm
rkhgihmqhiarqitkedfatfdyilcmdesnlrdlnrksnqvknckakiellgsydpqk
qliiedpyygndsdfevvyqqclrcckaflekt

SCOPe Domain Coordinates for d5jnua_:

Click to download the PDB-style file with coordinates for d5jnua_.
(The format of our PDB-style files is described here.)

Timeline for d5jnua_:

  • d5jnua_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30