SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mm9b_ (5mm9 B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2205699Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2205700Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2205701Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 protein domains)
  6. 2205847Protein automated matches [190079] (9 species)
    not a true protein
  7. 2205890Species Pseudomonas aeruginosa [TaxId:287] [189349] (29 PDB entries)
  8. 2289188Domain d5mm9b_: 5mm9 B: [332489]
    automated match to d5a87b_
    complexed with 8sh, mg, zn

Details for d5mm9b_

PDB Entry: 5mm9 (more details), 1.55 Å

PDB Description: vim-2_2b. metallo-beta-lactamase inhibitors by bioisosteric replacement: preparation, activity and binding
PDB Compounds: (B:) Metallo-beta-lactamase VIM-17

SCOPe Domain Sequences for d5mm9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mm9b_ d.157.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnr

SCOPe Domain Coordinates for d5mm9b_:

Click to download the PDB-style file with coordinates for d5mm9b_.
(The format of our PDB-style files is described here.)

Timeline for d5mm9b_:

  • d5mm9b_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30