Lineage for d5mmde_ (5mmd E:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2205699Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2205700Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2206129Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2206130Protein automated matches [190418] (18 species)
    not a true protein
  7. 2289186Species Acinetobacter baumannii [TaxId:470] [332487] (1 PDB entry)
  8. 2289187Domain d5mmde_: 5mmd E: [332488]
    automated match to d1jjeb_
    complexed with cl, zn

Details for d5mmde_

PDB Entry: 5mmd (more details), 1.75 Å

PDB Description: tmb-1. structural insights into tmb-1 and the role of residue 119 and 228 in substrate and inhibitor binding
PDB Compounds: (E:) Metallo-beta-lactamase 1

SCOPe Domain Sequences for d5mmde_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mmde_ d.157.1.0 (E:) automated matches {Acinetobacter baumannii [TaxId: 470]}
eipgleveeidngvflhksysrvegwglvssnglvvisggkafiidtpwsesdteklvdw
irskkyelagsisthshedktagikwlngksittyasaltneilkregkeqarssfkgne
fslmdgflevyypggghtidnlvvwipsskilyggcfirslessglgytgeakidqwpqs
arntiskypeakivvpghgkigdfellkhtkvlaekasnka

SCOPe Domain Coordinates for d5mmde_:

Click to download the PDB-style file with coordinates for d5mmde_.
(The format of our PDB-style files is described here.)

Timeline for d5mmde_:

  • d5mmde_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30