SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mmde_ (5mmd E:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2205699Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2205700Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2206129Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2206130Protein automated matches [190418] (18 species)
    not a true protein
  7. 2289186Species Acinetobacter baumannii [TaxId:470] [332487] (1 PDB entry)
  8. 2289187Domain d5mmde_: 5mmd E: [332488]
    automated match to d1jjeb_
    complexed with cl, zn

Details for d5mmde_

PDB Entry: 5mmd (more details), 1.75 Å

PDB Description: tmb-1. structural insights into tmb-1 and the role of residue 119 and 228 in substrate and inhibitor binding
PDB Compounds: (E:) Metallo-beta-lactamase 1

SCOPe Domain Sequences for d5mmde_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mmde_ d.157.1.0 (E:) automated matches {Acinetobacter baumannii [TaxId: 470]}
eipgleveeidngvflhksysrvegwglvssnglvvisggkafiidtpwsesdteklvdw
irskkyelagsisthshedktagikwlngksittyasaltneilkregkeqarssfkgne
fslmdgflevyypggghtidnlvvwipsskilyggcfirslessglgytgeakidqwpqs
arntiskypeakivvpghgkigdfellkhtkvlaekasnka

SCOPe Domain Coordinates for d5mmde_:

Click to download the PDB-style file with coordinates for d5mmde_.
(The format of our PDB-style files is described here.)

Timeline for d5mmde_:

  • d5mmde_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30