Lineage for d2ncea_ (2nce A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038038Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2038039Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2038183Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 protein domains)
    topologically similar to the C-terminal domain of PapD
  6. 2038246Protein automated matches [190234] (3 species)
    not a true protein
  7. 2038253Species Norway rat (Rattus norvegicus) [TaxId:10116] [186999] (9 PDB entries)
  8. 2289182Domain d2ncea_: 2nce A: [332483]
    automated match to d2uzpa_
    complexed with ca

Details for d2ncea_

PDB Entry: 2nce (more details)

PDB Description: solution structure of ca2+-bound c2 domain from protein kinase c alpha in the form of complex with v5-phm peptide
PDB Compounds: (A:) Protein kinase C alpha type

SCOPe Domain Sequences for d2ncea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ncea_ b.7.1.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
htekrgriylkaevtdeklhvtvrdaknlipmdpnglsdpyvklklipdpkneskqktkt
irstlnpqwnesftfklkpsdkdrrlsveiwdwdrttrndfmgslsfgvselmkmpasgw
ykllnqeegeyynvpipeg

SCOPe Domain Coordinates for d2ncea_:

Click to download the PDB-style file with coordinates for d2ncea_.
(The format of our PDB-style files is described here.)

Timeline for d2ncea_:

  • d2ncea_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30