SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2ncea_ (2nce A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038038Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2038039Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2038183Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 protein domains)
    topologically similar to the C-terminal domain of PapD
  6. 2038246Protein automated matches [190234] (3 species)
    not a true protein
  7. 2038253Species Norway rat (Rattus norvegicus) [TaxId:10116] [186999] (9 PDB entries)
  8. 2289182Domain d2ncea_: 2nce A: [332483]
    automated match to d2uzpa_
    complexed with ca

Details for d2ncea_

PDB Entry: 2nce (more details)

PDB Description: solution structure of ca2+-bound c2 domain from protein kinase c alpha in the form of complex with v5-phm peptide
PDB Compounds: (A:) Protein kinase C alpha type

SCOPe Domain Sequences for d2ncea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ncea_ b.7.1.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
htekrgriylkaevtdeklhvtvrdaknlipmdpnglsdpyvklklipdpkneskqktkt
irstlnpqwnesftfklkpsdkdrrlsveiwdwdrttrndfmgslsfgvselmkmpasgw
ykllnqeegeyynvpipeg

SCOPe Domain Coordinates for d2ncea_:

Click to download the PDB-style file with coordinates for d2ncea_.
(The format of our PDB-style files is described here.)

Timeline for d2ncea_:

  • d2ncea_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30