Lineage for d5n3wa3 (5n3w A:461-609)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006601Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein)
    automatically mapped to Pfam PF09127
  6. 2006602Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species)
  7. 2006603Species Human (Homo sapiens) [TaxId:9606] [63610] (56 PDB entries)
    Uniprot P09960
  8. 2289174Domain d5n3wa3: 5n3w A:461-609 [332475]
    Other proteins in same PDB: d5n3wa1, d5n3wa2
    automated match to d3u9wa3
    complexed with 8kw, act, imd, yb, zn

Details for d5n3wa3

PDB Entry: 5n3w (more details), 2.3 Å

PDB Description: crystal structure of lta4h bound to a selective inhibitor against ltb4 generation
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d5n3wa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n3wa3 a.118.1.7 (A:461-609) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm
qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks
hdqavrtyqehkasmhpvtamlvgkdlkv

SCOPe Domain Coordinates for d5n3wa3:

Click to download the PDB-style file with coordinates for d5n3wa3.
(The format of our PDB-style files is described here.)

Timeline for d5n3wa3:

  • d5n3wa3 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30