SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5n3wa3 (5n3w A:461-609)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006601Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein)
    automatically mapped to Pfam PF09127
  6. 2006602Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species)
  7. 2006603Species Human (Homo sapiens) [TaxId:9606] [63610] (50 PDB entries)
    Uniprot P09960
  8. 2289174Domain d5n3wa3: 5n3w A:461-609 [332475]
    Other proteins in same PDB: d5n3wa1, d5n3wa2
    automated match to d3u9wa3
    complexed with 8kw, act, imd, yb, zn

Details for d5n3wa3

PDB Entry: 5n3w (more details), 2.3 Å

PDB Description: crystal structure of lta4h bound to a selective inhibitor against ltb4 generation
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d5n3wa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n3wa3 a.118.1.7 (A:461-609) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm
qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks
hdqavrtyqehkasmhpvtamlvgkdlkv

SCOPe Domain Coordinates for d5n3wa3:

Click to download the PDB-style file with coordinates for d5n3wa3.
(The format of our PDB-style files is described here.)

Timeline for d5n3wa3:

  • d5n3wa3 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30